HORDB

ID: hor004646
Uniprot ID: Q3ECU1
Protein name: CLAVATA3/ESR (CLE)-related protein 11
Gene name: CLE11
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE11p]: Mostly expressed in seedlings, roots and siliques, and, to a lower extent, in leaves, flowers, stems and apex.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: TSYKLKSGINSLGHKRILASNFDFTPFLKNKDRTQRQRQSPSLTVKENGFWYNDEERVVPSGPNPLHH
Length: 68
Propeptide: MTKQPKPCSFLFHISLLSALFVFLLISFAFTTSYKLKSGINSLGHKRILASNFDFTPFLKNKDRTQRQRQSPSLTVKENGFWYNDEERVVPSGPNPLHH
Signal peptide: MTKQPKPCSFLFHISLLSALFVFLLISFAFT
Modification: T60 Hydroxyproline;T63 Hydroxyproline
Glycosylation: T63 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004646_AF2.pdb

hor004646_ESM.pdb

Mass:	907903	Formula:	C351H545N105O103
Absent amino acids:	CM	Common amino acids:	SKLN
pI:	10.62	Basic residues:	14
Polar residues:	23	Hydrophobic residues:	17
Hydrophobicity:	-106.03	Boman Index:	-18799
Half-Life:	7.2 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	60.15
Instability Index:	4725	Extinction Coefficient cystines:	8480
Absorbance 280nm:	126.57